FMO3 anticorps (N-Term)

N° du produit ABIN635154

Cet anticorps anti-FMO3 est un anticorps Lapin Polyclonal détectant FMO3 dans WB. Adapté pour Humain.

Aperçu rapide pour FMO3 anticorps (N-Term) (ABIN635154)

Antigène: FMO3 (Flavin Containing Monooxygenase 3 (FMO3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FMO3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FMO3 anticorps

Épitope: N-Term

Specificité: FMO3 antibody was raised against the N terminal of FMO3

Purification: Affinity purified

Immunogène: FMO3 antibody was raised using the N terminal of FMO3 corresponding to a region with amino acids MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FMO3 Blocking Peptide, (ABIN5613622), is also available for use as a blocking control in assays to test for specificity of this FMO3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FMO3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FMO3

Antigène: FMO3 (Flavin Containing Monooxygenase 3 (FMO3))

Autre désignation: FMO3

Sujet: FMO3 is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. It N-oxygenates primary aliphatic alkylamines as well as secondary and tertiary amines. It acts on TMA to produce TMA-N-oxide.

Poids moléculaire: 60 kDa (MW of target protein)